PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009623517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 913aa    MW: 101706 Da    PI: 7.0512
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009623517.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.9e-29594644252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  XP_009623517.1 594 EKSISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 644
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.405.6E-4187271IPR029016GAF domain-like
PROSITE profilePS5151917.427583664IPR003035RWP-RK domain
PfamPF020421.1E-24597644IPR003035RWP-RK domain
SuperFamilySSF542771.0E-22806901No hitNo description
Gene3DG3DSA:3.10.20.2405.9E-21814896No hitNo description
PfamPF005642.9E-17816897IPR000270PB1 domain
SMARTSM006664.4E-23816898IPR000270PB1 domain
PROSITE profilePS5174521.063816898IPR000270PB1 domain
CDDcd064074.46E-38817897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 913 aa     Download sequence    Send to blast
MEDGPFTLHD MFAKLSSDNT IATSDFSEFL SDGFWLETTN HASNFLTPSS LASQPLLLDT  60
TKAGHFLPTT DQLTLQEETD KDKILFAQMD DFSPTRRENS ETSPRRLWIG PNINPNPTLS  120
VKKRLVQAIE HLKDSTRDKD VLIQIWVPVK RGGKHVLITN NQPYFLNPNF QSLVEYRYVS  180
QNYQFAAEKD SKELVGLPGR VFLKKLPEWT PDVRFFKREE YPRVNHAHQY NVRGSIAVPV  240
FETGSGTCLG VVEIVTTTQK THYHPELEDV CKALEAVNLR SSGISNPAKI KDCNESYLAA  300
LAEIQYILTC VCDTHKLPLA QTWAPCIQQG KGGCLRDENF TFCVTTVDEA CYVRDPQVLP  360
FHYACSEHHL LKGEGVAGGA FNTNQPCFAT DITAFSKTEY PLSHHARMFG LCSAVAIRLR  420
SIYTGSADFV LEFFLPLDCK NTEDQKQMLS SLSSVIQQSC RSLRVVTDQE LQEEKELLQR  480
EKVILSAGES HEEISRKPVS PPYGDQDASS WLSQMMDSQR KGKGAAVSQE ENFKVTANHW  540
RESIHASTYS EPNQIQDNFG PNGGSGGSLD FSSGTGSHSS GAKRAGERRR SKTEKSISLQ  600
VLRQYFAGSL KDAAKSIGVC PTTLKRICRQ HGITRWPSRK IKKVGHSLQK LQLVIDSVHG  660
AEGAIKLSSF YTNFPELTSP NNPGTSNLSA SKNHDHLQQV NTQPDGSALS PVTTTSKSTS  720
SSGSHNSSSS LFCSTDSKHL FPLTNVFATG NATMEEHPGG MLKRAHTEAE LHDMGQEETK  780
LLVRSQSQKI QSNHISLEPL CPLPTSSNQV IRDSATFKVK ATFGKEKIRF SLQSHWGFID  840
VQQEVLRRFN IEDGKIDLKY LDDDDEWVLL TCDADLEECI DIHRLCKRRT IKVSLHHAYH  900
PNLGSSFGSS GPA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1883892RLCKRRTIKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401980.0AC240198.1 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-219g5 map 1, complete sequence.
GenBankAC2465860.0AC246586.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-20o20 map 1, complete sequence.
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009623517.10.0PREDICTED: protein NLP2-like
RefseqXP_016493353.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A0V0IVX10.0A0A0V0IVX1_SOLCH; Uncharacterized protein
STRINGSolyc01g112190.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein